OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUDT3 (NM_006703) Human Mass Spec Standard

Be the first to review this product
SKU
PH302900
NUDT3 MS Standard C13 and N15-labeled recombinant protein (NP_006694)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA332026 Rabbit Polyclonal Anti-NUDT3 Antibody
100 ul
$585.00

Other products for "NUDT3 or NM_006703"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202900
Predicted MW 19.3 kDa
Protein Sequence
Protein Sequence
>RC202900 representing NM_006703
Red=Cloning site Green=Tags(s)

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEE
AGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYF
ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006694
RefSeq Size 1371
RefSeq ORF 516
Synonyms DIPP; DIPP-1; DIPP1
Locus ID 11165
UniProt ID O95989
Cytogenetics 6p21.31
Summary NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 PubMed 9822604).supplied by OMIM, Feb 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NUDT3" proteins (1)
SKU Description Size Price
TP302900 Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 3 (NUDT3), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products