OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IMPA1 (NM_005536) Human Mass Spec Standard

Be the first to review this product
SKU
PH302784
IMPA1 MS Standard C13 and N15-labeled recombinant protein (NP_005527)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377494 IMPA1 Rabbit polyclonal Antibody
100 ul
$410.00
LY417241 Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "IMPA1 or NM_005536"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202784
Predicted MW 30.2 kDa
Protein Sequence
Protein Sequence
>RC202784 protein sequence
Red=Cloning site Green=Tags(s)

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGE
ESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAF
CNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADA
YYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005527
RefSeq Size 3396
RefSeq ORF 831
Synonyms IMP; IMPA; MRT59
Locus ID 3612
UniProt ID P29218
Cytogenetics 8q21.13
Summary This gene encodes an enzyme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13. provided by RefSeq, Dec 2014
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IMPA1" proteins (6)
SKU Description Size Price
LC417241 Lyophilized IMPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428539 Lyophilized IMPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417241 Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428539 Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302784 Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1, 20 µg 20 ug
$867.00
TP720208 Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 2 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products