OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RGS2 (NM_002923) Human Mass Spec Standard

Be the first to review this product
SKU
PH302781
RGS2 MS Standard C13 and N15-labeled recombinant protein (NP_002914)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321542 Anti-RGS2 Rabbit Polyclonal Antibody
100 ul
$305.00
LY401021 Transient overexpression lysate of regulator of G-protein signaling 2, 24kDa (RGS2) (as WB positive control) 100 ug
$436.00

Other products for "RGS2 or NM_002923"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202781
Predicted MW 24.4 kDa
Protein Sequence
Protein Sequence
>RC202781 protein sequence
Red=Cloning site Green=Tags(s)

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI
KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI
EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA
T

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002914
RefSeq Size 1375
RefSeq ORF 633
Synonyms G0S8
Locus ID 5997
UniProt ID P41220
Cytogenetics 1q31.2
Summary Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis. provided by RefSeq, Aug 2009
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RGS2" proteins (3)
SKU Description Size Price
LC401021 Lyophilized RGS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401021 Transient overexpression lysate of regulator of G-protein signaling 2, 24kDa (RGS2) (as WB positive control) 100 ug
$436.00
TP302781 Recombinant protein of human regulator of G-protein signaling 2, 24kDa (RGS2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products