OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PREI3 (MOB4) (NM_199482) Human Mass Spec Standard

Be the first to review this product
SKU
PH302689
MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_955776)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402432 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PREI3 or NM_199482"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202689
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC202689 representing NM_199482
Red=Cloning site Green=Tags(s)

MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWK
YEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNK
YFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI
LEEEVQNSVSGESEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_955776
RefSeq Size 2698
RefSeq ORF 675
Synonyms 2C4D; CGI-95; MOB1; MOB3; MOBKL3; PHOCN; PREI3
Locus ID 25843
UniProt ID Q9Y3A3
Cytogenetics 2q33.1
Summary This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.provided by RefSeq, Feb 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PREI3" proteins (8)
SKU Description Size Price
PH313507 MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_056202) 10 ug
$3,360.00
LC402432 Lyophilized MOB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404580 Lyophilized MOB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402432 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404580 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302689 Purified recombinant protein of Homo sapiens MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2, 20 µg 20 ug
$867.00
TP313507 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1, 20 µg 20 ug
$867.00
TP720256 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 3 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products