OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERPINB3 (NM_006919) Human Mass Spec Standard

Be the first to review this product
SKU
PH302683
SERPINB3 MS Standard C13 and N15-labeled recombinant protein (NP_008850)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506878 SERPINB3 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12) 100 ul
$447.00
LY416321 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3) (as WB positive control) 100 ug
$436.00

Other products for "SERPINB3 or NM_006919"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202683
Predicted MW 44.6 kDa
Protein Sequence
Protein Sequence
>RC202683 protein sequence
Red=Cloning site Green=Tags(s)

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKA
ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAP
EESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSI
QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV
DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV
GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008850
RefSeq Size 1793
RefSeq ORF 1170
Synonyms HsT1196; SCC; SCCA-1; SCCA-PD; SCCA1; SSCA1; T4-A
Locus ID 6317
UniProt ID P29508
Cytogenetics 18q21.33
Summary May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERPINB3" proteins (4)
SKU Description Size Price
LC416321 Lyophilized SERPINB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416321 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3) (as WB positive control) 100 ug
$436.00
TP302683 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), 20 µg 20 ug
$737.00
TP790063 Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), with N-terminal HIS tag, expressed in HEK293, 50ug 50 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products