OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRPT1 (NM_031472) Human Mass Spec Standard

Be the first to review this product
SKU
PH302609
TRPT1 MS Standard C13 and N15-labeled recombinant protein (NP_113660)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA371055 TRPT1 rabbit polyclonal antibody
100 ul
$310.00
LY410478 Transient overexpression lysate of tRNA phosphotransferase 1 (TRPT1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "TRPT1 or NM_031472"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202609
Predicted MW 22.4 kDa
Protein Sequence
Protein Sequence
>RC202609 protein sequence
Red=Cloning site Green=Tags(s)

MGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLE
TPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGI
PFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_113660
RefSeq Size 987
RefSeq ORF 612
Locus ID 83707
UniProt ID Q86TN4
Cytogenetics 11q13.1
Summary Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRPT1" proteins (3)
SKU Description Size Price
LC410478 Lyophilized TRPT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410478 Transient overexpression lysate of tRNA phosphotransferase 1 (TRPT1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302609 Recombinant protein of human tRNA phosphotransferase 1 (TRPT1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products