OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COX5B (NM_001862) Human Mass Spec Standard

Be the first to review this product
SKU
PH302511
COX5B MS Standard C13 and N15-labeled recombinant protein (NP_001853)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375016 COX5B Rabbit polyclonal Antibody
100 ul
$410.00
LY419690 Transient overexpression lysate of cytochrome c oxidase subunit Vb (COX5B) (as WB positive control) 100 ug
$436.00

Other products for "COX5B or NM_001862"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202511
Predicted MW 13.7 kDa
Protein Sequence
Protein Sequence
>RC202511 protein sequence
Red=Cloning site Green=Tags(s)

MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGA
SGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001853
RefSeq Size 523
RefSeq ORF 387
Synonyms COXVB
Locus ID 1329
UniProt ID P10606
Cytogenetics 2q11.2
Summary Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. provided by RefSeq, Jul 2008
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COX5B" proteins (3)
SKU Description Size Price
LC419690 Lyophilized COX5B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419690 Transient overexpression lysate of cytochrome c oxidase subunit Vb (COX5B) (as WB positive control) 100 ug
$436.00
TP302511 Recombinant protein of human cytochrome c oxidase subunit Vb (COX5B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products