OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FUS2 (NAT6) (NM_012191) Human Mass Spec Standard

Be the first to review this product
SKU
PH302498
NAT6 MS Standard C13 and N15-labeled recombinant protein (NP_036323)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346764 Rabbit Polyclonal Anti-NAT6 Antibody
100 ul
$585.00
LY415920 Transient overexpression lysate of N-acetyltransferase 6 (GCN5-related) (NAT6) (as WB positive control) 100 ug
$436.00

Other products for "FUS2 or NM_012191"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202498
Predicted MW 33.8 kDa
Protein Sequence
Protein Sequence
>RC202498 protein sequence
Red=Cloning site Green=Tags(s)

MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQ
PEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAP
VVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGY
QLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVP
SGPPSKSLLETQYQNVRGRPIFWMEKDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036323
RefSeq Size 1358
RefSeq ORF 924
Synonyms FUS-2; FUS2; HsNAAA80; NAT6
Locus ID 24142
UniProt ID Q93015
Cytogenetics 3p21.31
Summary This gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon. provided by RefSeq, Jan 2011
Protein Pathways Glycerophospholipid metabolism, Limonene and pinene degradation, Phenylalanine metabolism, Tyrosine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FUS2" proteins (3)
SKU Description Size Price
LC415920 Lyophilized NAT6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415920 Transient overexpression lysate of N-acetyltransferase 6 (GCN5-related) (NAT6) (as WB positive control) 100 ug
$436.00
TP302498 Recombinant protein of human N-acetyltransferase 6 (GCN5-related) (NAT6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products