OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHAF1 (NM_025187) Human Mass Spec Standard

Be the first to review this product
SKU
PH302484
C16orf70 MS Standard C13 and N15-labeled recombinant protein (NP_079463)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358364 C16orf70 Antibody - C-terminal region
100 ul
$585.00
LY403058 Transient overexpression lysate of chromosome 16 open reading frame 70 (C16orf70) (as WB positive control) 100 ug
$436.00

Other products for "C16orf70 or NM_025187"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202484
Predicted MW 47.5 kDa
Protein Sequence
Protein Sequence
>RC202484 protein sequence
Red=Cloning site Green=Tags(s)

MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFD
AFNQRLKVIEVCDLTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVYNSAEQLFHLNFRGLSFSFQL
DSWTEAPKYEPNFAHGLASLQIPHGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTGP
AGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSK
CNDYFFNYFTLGVDILFDANTHKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENADGQTETCTTYSK
WDNIQELLGHPVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYGPPRPGSHLRTAE
LP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079463
RefSeq Size 2943
RefSeq ORF 1266
Synonyms C16orf6; lin-10; LIN10
Locus ID 80262
UniProt ID Q9BSU1
Cytogenetics 16q22.1
Summary Plays a regulatory role in autophagic activity. In complex with BCAS3, associates with the autophagosome formation site during both non-selective and selective autophagy.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C16orf70" proteins (3)
SKU Description Size Price
LC403058 Lyophilized C16orf70 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403058 Transient overexpression lysate of chromosome 16 open reading frame 70 (C16orf70) (as WB positive control) 100 ug
$436.00
TP302484 Recombinant protein of human chromosome 16 open reading frame 70 (C16orf70), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products