OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GMPR1 (GMPR) (NM_006877) Human Mass Spec Standard

Be the first to review this product
SKU
PH302453
GMPR MS Standard C13 and N15-labeled recombinant protein (NP_006868)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811370 GMPR mouse monoclonal antibody,clone OTI1E8 100 ul
$447.00
LY416357 Transient overexpression lysate of guanosine monophosphate reductase (GMPR) (as WB positive control) 100 ug
$436.00

Other products for "GMPR1 or NM_006877"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202453
Predicted MW 37.4 kDa
Protein Sequence
Protein Sequence
>RC202453 protein sequence
Red=Cloning site Green=Tags(s)

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH
SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE
FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH
GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAG
GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006868
RefSeq Size 1515
RefSeq ORF 1035
Synonyms GMPR 1; GMPR1
Locus ID 2766
UniProt ID P36959
Cytogenetics 6p22.3
Summary This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.provided by RefSeq, Oct 2009
Protein Families Druggable Genome
Protein Pathways Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GMPR1" proteins (3)
SKU Description Size Price
LC416357 Lyophilized GMPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416357 Transient overexpression lysate of guanosine monophosphate reductase (GMPR) (as WB positive control) 100 ug
$436.00
TP302453 Recombinant protein of human guanosine monophosphate reductase (GMPR), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products