OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GOLPH3L (NM_018178) Human Mass Spec Standard

Be the first to review this product
SKU
PH302398
GOLPH3L MS Standard C13 and N15-labeled recombinant protein (NP_060648)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337326 Rabbit Polyclonal Anti-GOLPH3L Antibody
100 ul
$585.00
LY413097 Transient overexpression lysate of golgi phosphoprotein 3-like (GOLPH3L) (as WB positive control) 100 ug
$436.00

Other products for "GOLPH3L or NM_018178"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202398
Predicted MW 32.8 kDa
Protein Sequence
Protein Sequence
>RC202398 protein sequence
Red=Cloning site Green=Tags(s)

MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKEGYTSFWNDC
ISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIE
LLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLER
WVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLA
AFNKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060648
RefSeq Size 3208
RefSeq ORF 855
Synonyms GPP34R
Locus ID 55204
UniProt ID Q9H4A5
Cytogenetics 1q21.3
Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GOLPH3L" proteins (3)
SKU Description Size Price
LC413097 Lyophilized GOLPH3L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413097 Transient overexpression lysate of golgi phosphoprotein 3-like (GOLPH3L) (as WB positive control) 100 ug
$436.00
TP302398 Recombinant protein of human golgi phosphoprotein 3-like (GOLPH3L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products