OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CNIH3 (NM_152495) Human Mass Spec Standard

Be the first to review this product
SKU
PH302120
CNIH3 MS Standard C13 and N15-labeled recombinant protein (NP_689708)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407502 Transient overexpression lysate of cornichon homolog 3 (Drosophila) (CNIH3) (as WB positive control) 100 ug
$436.00

Other products for "CNIH3 or NM_152495"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202120
Predicted MW 19 kDa
Protein Sequence
Protein Sequence
>RC202120 protein sequence
Red=Cloning site Green=Tags(s)

MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLP
EYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLA
FYLLSFFYYLYCMIYTLVSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689708
RefSeq Size 2372
RefSeq ORF 480
Synonyms CNIH-3
Locus ID 149111
UniProt ID Q8TBE1
Cytogenetics 1q42.12
Summary Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CNIH3" proteins (3)
SKU Description Size Price
LC407502 Lyophilized CNIH3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407502 Transient overexpression lysate of cornichon homolog 3 (Drosophila) (CNIH3) (as WB positive control) 100 ug
$436.00
TP302120 Recombinant protein of human cornichon homolog 3 (Drosophila) (CNIH3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products