OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRRC42 (NM_052940) Human Mass Spec Standard

Be the first to review this product
SKU
PH301955
LRRC42 MS Standard C13 and N15-labeled recombinant protein (NP_443172)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340222 Rabbit Polyclonal Anti-LRRC42 Antibody
100 ul
$585.00
LY409375 Transient overexpression lysate of leucine rich repeat containing 42 (LRRC42) (as WB positive control) 100 ug
$436.00

Other products for "LRRC42 or NM_052940"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201955
Predicted MW 48.6 kDa
Protein Sequence
Protein Sequence
>RC201955 protein sequence
Red=Cloning site Green=Tags(s)

MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNREDDTARKEKTD
HFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQK
FTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDLSCCKLGDEHELLEHLTNEALSSVTQLHLKD
NCLSDAGVRKMTAPVRVMKRGLENLTLLDLSCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKTVKHKL
QTHIGLVHSKVPLKEFDHSNCKTEGWADQIVLQWERVTAEAVKPRETSEPRAAAQRFYGKRSRAEAPLKC
PLADTHMNSSEKLQFYKEKAPDCHGPVLKHEAISSQESKKSKKRPFEESETEQNNSSQPSKQKYVCLAVE
DWDLLNSY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443172
RefSeq Size 1770
RefSeq ORF 1284
Synonyms dJ167A19.4
Locus ID 115353
UniProt ID Q9Y546
Cytogenetics 1p32.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRRC42" proteins (3)
SKU Description Size Price
LC409375 Lyophilized LRRC42 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409375 Transient overexpression lysate of leucine rich repeat containing 42 (LRRC42) (as WB positive control) 100 ug
$436.00
TP301955 Recombinant protein of human leucine rich repeat containing 42 (LRRC42), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products