OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STAMBPL1 (NM_020799) Human Mass Spec Standard

Be the first to review this product
SKU
PH301884
STAMBPL1 MS Standard C13 and N15-labeled recombinant protein (NP_065850)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359278 STAMBPL1 Antibody - C-terminal region
100 ul
$585.00
LY402811 Transient overexpression lysate of STAM binding protein-like 1 (STAMBPL1) (as WB positive control) 100 ug
$436.00

Other products for "STAMBPL1 or NM_020799"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201884
Predicted MW 49.8 kDa
Protein Sequence
Protein Sequence
>RC201884 protein sequence
Red=Cloning site Green=Tags(s)

MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMERMASVYLEEGN
LENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKNDLLKKYNVEYQEYLQSK
NKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSA
LSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFL
QLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHP
TQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065850
RefSeq Size 2094
RefSeq ORF 1308
Synonyms ALMalpha; AMSH-FP; AMSH-LP; bA399O19.2
Locus ID 57559
UniProt ID Q96FJ0
Cytogenetics 10q23.31
Summary Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STAMBPL1" proteins (3)
SKU Description Size Price
LC402811 Lyophilized STAMBPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402811 Transient overexpression lysate of STAM binding protein-like 1 (STAMBPL1) (as WB positive control) 100 ug
$436.00
TP301884 Recombinant protein of human STAM binding protein-like 1 (STAMBPL1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products