OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNX1 (NM_003099) Human Mass Spec Standard

Be the first to review this product
SKU
PH301844
SNX1 MS Standard C13 and N15-labeled recombinant protein (NP_003090)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA311255 Goat Anti-SNX1 Antibody
100 ug
$565.00
LY407727 Transient overexpression lysate of sorting nexin 1 (SNX1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "SNX1 or NM_003099"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201844
Predicted MW 59.1 kDa
Protein Sequence
Protein Sequence
>RC201844 protein sequence
Red=Cloning site Green=Tags(s)

MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINN
GSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQE
DQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPP
PPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLS
GAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKS
LAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFK
NHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003090
RefSeq Size 8332
RefSeq ORF 1566
Synonyms HsT17379; VPS5
Locus ID 6642
UniProt ID Q13596
Cytogenetics 15q22.31
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNX1" proteins (5)
SKU Description Size Price
LC407727 Lyophilized SNX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418900 Lyophilized SNX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407727 Transient overexpression lysate of sorting nexin 1 (SNX1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY418900 Transient overexpression lysate of sorting nexin 1 (SNX1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301844 Recombinant protein of human sorting nexin 1 (SNX1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products