OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FADD (NM_003824) Human Mass Spec Standard

Be the first to review this product
SKU
PH301805
FADD MS Standard C13 and N15-labeled recombinant protein (NP_003815)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501434 Anti-FADD mouse monoclonal antibody, clone OTI1C11 (formerly 1C11) 100 ul
$447.00
LY401265 Transient overexpression lysate of Fas (TNFRSF6)-associated via death domain (FADD) (as WB positive control) 100 ug
$436.00

Other products for "FADD or NM_003824"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201805
Predicted MW 23.3 kDa
Protein Sequence
Protein Sequence
>RC201805 protein sequence
Red=Cloning site Green=Tags(s)

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASL
RRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTER
VRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003815
RefSeq Size 1855
RefSeq ORF 624
Synonyms GIG3; MORT1
Locus ID 8772
UniProt ID Q13158
Cytogenetics 11q13.3
Summary The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Apoptosis, Pathways in cancer, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FADD" proteins (3)
SKU Description Size Price
LC401265 Lyophilized FADD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401265 Transient overexpression lysate of Fas (TNFRSF6)-associated via death domain (FADD) (as WB positive control) 100 ug
$436.00
TP301805 Recombinant protein of human Fas (TNFRSF6)-associated via death domain (FADD), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products