OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2N (NM_003348) Human Mass Spec Standard

Be the first to review this product
SKU
PH301792
UBE2N MS Standard C13 and N15-labeled recombinant protein (NP_003339)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367823 UBE2N rabbit polyclonal antibody
100 ul
$310.00
LY418741 Transient overexpression lysate of ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N) (as WB positive control) 100 ug
$436.00

Other products for "UBE2N or NM_003348"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201792
Predicted MW 17.1 kDa
Protein Sequence
Protein Sequence
>RC201792 protein sequence
Red=Cloning site Green=Tags(s)

MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR
FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA
RAWTRLYAMNNI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003339
RefSeq Size 2568
RefSeq ORF 456
Synonyms HEL-S-71; UBC13; UbcH-ben; UbcH13; UBCHBEN
Locus ID 7334
UniProt ID P61088
Cytogenetics 12q22
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2N" proteins (3)
SKU Description Size Price
LC418741 Lyophilized UBE2N HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418741 Transient overexpression lysate of ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N) (as WB positive control) 100 ug
$436.00
TP301792 Recombinant protein of human ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products