OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TWF2 (NM_007284) Human Mass Spec Standard

Be the first to review this product
SKU
PH301791
TWF2 MS Standard C13 and N15-labeled recombinant protein (NP_009215)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349590 Rabbit Polyclonal Anti-TWF2 Antibody
100 ul
$205.00
LY402125 Transient overexpression lysate of twinfilin, actin-binding protein, homolog 2 (Drosophila) (TWF2) (as WB positive control) 100 ug
$436.00

Other products for "TWF2 or NM_007284"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201791
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC201791 protein sequence
Red=Cloning site Green=Tags(s)

MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLL
YRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDELFGTVKDDLSFAGYQKHLSS
CAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERE
TIELVHTEPTDVAQLPSRVPRDAARYHFFLYKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLL
DSVEQDFHLEIAKKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENGDDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009215
RefSeq Size 1659
RefSeq ORF 1047
Synonyms A6r; A6RP; MSTP011; PTK9L
Locus ID 11344
UniProt ID Q6IBS0
Cytogenetics 3p21.2
Summary The protein encoded by this gene was identified by its interaction with the catalytic domain of protein kinase C-zeta. The encoded protein contains an actin-binding site and an ATP-binding site. It is most closely related to twinfilin (PTK9), a conserved actin monomer-binding protein. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TWF2" proteins (3)
SKU Description Size Price
LC402125 Lyophilized TWF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402125 Transient overexpression lysate of twinfilin, actin-binding protein, homolog 2 (Drosophila) (TWF2) (as WB positive control) 100 ug
$436.00
TP301791 Recombinant protein of human twinfilin, actin-binding protein, homolog 2 (Drosophila) (TWF2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products