OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NTF2 (NUTF2) (NM_005796) Human Mass Spec Standard

Be the first to review this product
SKU
PH301728
NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417082 Transient overexpression lysate of nuclear transport factor 2 (NUTF2) (as WB positive control) 100 ug
$436.00

Other products for "NTF2 or NM_005796"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201728
Predicted MW 14.5 kDa
Protein Sequence
Protein Sequence
>RC201728 protein sequence
Red=Cloning site Green=Tags(s)

MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA
QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005787
RefSeq Size 894
RefSeq ORF 381
Synonyms NTF-2; NTF2; PP15
Locus ID 10204
UniProt ID P61970
Cytogenetics 16q22.1
Summary This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62. provided by RefSeq, Apr 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NTF2" proteins (3)
SKU Description Size Price
LC417082 Lyophilized NUTF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417082 Transient overexpression lysate of nuclear transport factor 2 (NUTF2) (as WB positive control) 100 ug
$436.00
TP301728 Recombinant protein of human nuclear transport factor 2 (NUTF2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products