OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

XTP3TPA (DCTPP1) (NM_024096) Human Mass Spec Standard

Be the first to review this product
SKU
PH301727
DCTPP1 MS Standard C13 and N15-labeled recombinant protein (NP_077001)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366381 DCTPP1 rabbit polyclonal antibody
100 ul
$310.00
LY411367 Transient overexpression lysate of dCTP pyrophosphatase 1 (DCTPP1) (as WB positive control) 100 ug
$436.00

Other products for "XTP3TPA or NM_024096"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201727
Predicted MW 18.7 kDa
Protein Sequence
Protein Sequence
>RC201727 protein sequence
Red=Cloning site Green=Tags(s)

MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL
FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK
YTELPHGAISEDQAVGPADIPCDSTGQTST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077001
RefSeq Size 1143
RefSeq ORF 510
Synonyms CDA03; RS21C6; XTP3TPA
Locus ID 79077
UniProt ID Q9H773
Cytogenetics 16p11.2
Summary The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene. provided by RefSeq, Dec 2015
Protein Families Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "XTP3TPA" proteins (3)
SKU Description Size Price
LC411367 Lyophilized DCTPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411367 Transient overexpression lysate of dCTP pyrophosphatase 1 (DCTPP1) (as WB positive control) 100 ug
$436.00
TP301727 Recombinant protein of human dCTP pyrophosphatase 1 (DCTPP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products