OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUP37 (NM_024057) Human Mass Spec Standard

Be the first to review this product
SKU
PH301720
NUP37 MS Standard C13 and N15-labeled recombinant protein (NP_076962)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA360493 NUP37 Antibody - middle region
100 ul
$585.00
LY411376 Transient overexpression lysate of nucleoporin 37kDa (NUP37) (as WB positive control) 100 ug
$436.00

Other products for "NUP37 or NM_024057"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201720
Predicted MW 36.7 kDa
Protein Sequence
Protein Sequence
>RC201720 protein sequence
Red=Cloning site Green=Tags(s)

MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEGIQYKTLRTFH
HGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEI
ASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLLAQQAILSLESEQVP
LMSAHWCLKNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQF
QIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076962
RefSeq Size 1228
RefSeq ORF 978
Synonyms MCPH24; p37
Locus ID 79023
UniProt ID Q8NFH4
Cytogenetics 12q23.2
Summary Nuclear pore complexes (NPCs) are used for transporting macromolecules between the cytoplasm and the nucleus. NPCs consist of multiple copies of 30 distinct proteins (nucleoporins), which assemble into biochemically-separable subcomplexes. The protein encoded by this gene is part of a subcomplex (Nup107-160) that is required for proper NPC function as well as for normal kinetochore-microtubule interaction and mitosis. provided by RefSeq, Dec 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NUP37" proteins (4)
SKU Description Size Price
LC411376 Lyophilized NUP37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411376 Transient overexpression lysate of nucleoporin 37kDa (NUP37) (as WB positive control) 100 ug
$436.00
TP301720 Recombinant protein of human nucleoporin 37kDa (NUP37), 20 µg 20 ug
$737.00
TP761508 Purified recombinant protein of Human nucleoporin 37kDa (NUP37), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products