OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CMBL (NM_138809) Human Mass Spec Standard

Be the first to review this product
SKU
PH301711
CMBL MS Standard C13 and N15-labeled recombinant protein (NP_620164)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408494 Transient overexpression lysate of carboxymethylenebutenolidase homolog (Pseudomonas) (CMBL) (as WB positive control) 100 ug
$436.00

Other products for "CMBL or NM_138809"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201711
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC201711 protein sequence
Red=Cloning site Green=Tags(s)

MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNG
YTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHH
LMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKVEYQIKTFSGQ
THGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620164
RefSeq Size 4047
RefSeq ORF 735
Synonyms JS-1
Locus ID 134147
UniProt ID Q96DG6
Cytogenetics 5p15.2
Summary CMBL (EC 3.1.1.45) is a cysteine hydrolase of the dienelactone hydrolase family that is highly expressed in liver cytosol. CMBL preferentially cleaves cyclic esters, and it activates medoxomil-ester prodrugs in which the medoxomil moiety is linked to an oxygen atom (Ishizuka et al., 2010 PubMed 20177059).supplied by OMIM, Apr 2010
Protein Pathways Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CMBL" proteins (3)
SKU Description Size Price
LC408494 Lyophilized CMBL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408494 Transient overexpression lysate of carboxymethylenebutenolidase homolog (Pseudomonas) (CMBL) (as WB positive control) 100 ug
$436.00
TP301711 Recombinant protein of human carboxymethylenebutenolidase homolog (Pseudomonas) (CMBL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products