OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SUGT1 (NM_006704) Human Mass Spec Standard

Be the first to review this product
SKU
PH301676
SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_006695)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810100 SUGT1 mouse monoclonal antibody,clone OTI7B4 100 ul
$447.00
LY416475 Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SUGT1 or NM_006704"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201676
Predicted MW 37.8 kDa
Protein Sequence
Protein Sequence
>RC201676 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK
SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKI
KYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKI
EIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRL
FQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006695
RefSeq Size 1705
RefSeq ORF 999
Synonyms SGT1
Locus ID 10910
UniProt ID Q9Y2Z0
Cytogenetics 13q14.3
Summary This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. provided by RefSeq, Mar 2016
Protein Pathways NOD-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SUGT1" proteins (7)
SKU Description Size Price
PH325548 SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_001124384) 10 ug
$3,360.00
LC416475 Lyophilized SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427302 Lyophilized SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416475 Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427302 Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301676 Recombinant protein of human SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2, 20 µg 20 ug
$737.00
TP325548 Purified recombinant protein of Homo sapiens SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products