OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MED10 (NM_032286) Human Mass Spec Standard

Be the first to review this product
SKU
PH301665
MED10 MS Standard C13 and N15-labeled recombinant protein (NP_115662)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410229 Transient overexpression lysate of mediator complex subunit 10 (MED10) (as WB positive control) 100 ug
$436.00

Other products for "MED10 or NM_032286"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201665
Predicted MW 15.7 kDa
Protein Sequence
Protein Sequence
>RC201665 protein sequence
Red=Cloning site Green=Tags(s)

MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEY
IDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115662
RefSeq Size 1059
RefSeq ORF 405
Synonyms L6; NUT2; TRG20
Locus ID 84246
UniProt ID Q9BTT4
Cytogenetics 5p15.31
Summary MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 PubMed 12584197).supplied by OMIM, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MED10" proteins (3)
SKU Description Size Price
LC410229 Lyophilized MED10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410229 Transient overexpression lysate of mediator complex subunit 10 (MED10) (as WB positive control) 100 ug
$436.00
TP301665 Recombinant protein of human mediator complex subunit 10 (MED10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products