OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SRP54 (NM_003136) Human Mass Spec Standard

Be the first to review this product
SKU
PH301658
SRP54 MS Standard C13 and N15-labeled recombinant protein (NP_003127)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350416 Rabbit Polyclonal Anti-SRP54 Antibody
100 ul
$205.00
LY431398 Transient overexpression lysate of signal recognition particle 54kDa (SRP54), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SRP54 or NM_003136"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201658
Predicted MW 55.5 kDa
Protein Sequence
Protein Sequence
>RC201658 representing NM_003136
Red=Cloning site Green=Tags(s)

MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLN
KRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTF
RAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVAN
AIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHID
DFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILG
MIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQG
AAGNMKGMMGFNNM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003127
RefSeq Size 2164
RefSeq ORF 1512
Synonyms SCN8
Locus ID 6729
UniProt ID P61011
Cytogenetics 14q13.2
Summary Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).UniProtKB/Swiss-Prot Function
Protein Pathways Protein export
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SRP54" proteins (5)
SKU Description Size Price
LC418879 Lyophilized SRP54 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431398 Lyophilized SRP54 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418879 Transient overexpression lysate of signal recognition particle 54kDa (SRP54), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431398 Transient overexpression lysate of signal recognition particle 54kDa (SRP54), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301658 Recombinant protein of human signal recognition particle 54kDa (SRP54), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products