OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Mass Spec Standard

Be the first to review this product
SKU
PH301605
PSMB6 MS Standard C13 and N15-labeled recombinant protein (NP_002789)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380454 PSMB6 Rabbit polyclonal Antibody
100 ul
$410.00
LY419101 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6) (as WB positive control) 100 ug
$436.00

Other products for "Proteasome 20S beta 6 or NM_002798"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201605
Predicted MW 25.4 kDa
Protein Sequence
Protein Sequence
>RC201605 protein sequence
Red=Cloning site Green=Tags(s)

MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTP
IHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQ
EGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRL
AAIAESGVERQVLLGDQIPKFAVATLPPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002789
RefSeq Size 869
RefSeq ORF 717
Synonyms DELTA; LMPY; Y
Locus ID 5694
UniProt ID P28072
Cytogenetics 17p13.2
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. The encoded protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jul 2012
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Proteasome 20S beta 6" proteins (3)
SKU Description Size Price
LC419101 Lyophilized PSMB6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419101 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6) (as WB positive control) 100 ug
$436.00
TP301605 Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products