OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SULT1A1 (NM_001055) Human Mass Spec Standard

Be the first to review this product
SKU
PH301601
SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001046)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501951 SULT1A1 mouse monoclonal antibody, clone OTI9B7 (formerly 9B7) 100 ul
$447.00
LY420735 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SULT1A1 or NM_001055"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201601
Predicted MW 34.1 kDa
Protein Sequence
Protein Sequence
>RC201601 protein sequence
Red=Cloning site Green=Tags(s)

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC
HRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY
HFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF
VGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY
AEKMAGCSLSFRSEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001046
RefSeq Size 1254
RefSeq ORF 885
Synonyms HAST1/HAST2; P-PST; P-PST 1; PST; ST1A1; ST1A3; STP; STP1; ts-PST; TSPST1
Locus ID 6817
UniProt ID P50225
Cytogenetics 16p11.2
Summary Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Protein Pathways Sulfur metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SULT1A1" proteins (18)
SKU Description Size Price
PH311105 SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803566) 10 ug
$3,360.00
PH312038 SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803565) 10 ug
$3,360.00
PH312198 SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803878) 10 ug
$3,360.00
LC406098 Lyophilized SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406099 Lyophilized SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406103 Lyophilized SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406105 Lyophilized SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420735 Lyophilized SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406098 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY406099 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY406103 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY406105 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY420735 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301601 Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1, 20 µg 20 ug
$867.00
TP311105 Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3, 20 µg 20 ug
$867.00
TP312038 Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2, 20 µg 20 ug
$867.00
TP312198 Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4, 20 µg 20 ug
$867.00
TP720941 Purified recombinant protein of Human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products