OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ORC4L (ORC4) (NM_002552) Human Mass Spec Standard

Be the first to review this product
SKU
PH301587
ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_002543)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370338 ORC4 rabbit polyclonal antibody
100 ul
$310.00
LY405645 Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "ORC4L or NM_002552"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201587
Predicted MW 50.4 kDa
Protein Sequence
Protein Sequence
>RC201587 protein sequence
Red=Cloning site Green=Tags(s)

MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRG
SGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLL
EALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRF
SHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLH
MLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVY
NEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002543
RefSeq Size 6594
RefSeq ORF 1308
Synonyms ORC4L; ORC4P
Locus ID 5000
UniProt ID O43929
Cytogenetics 2q23.1
Summary The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. provided by RefSeq, Oct 2010
Protein Pathways Cell cycle
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ORC4L" proteins (13)
SKU Description Size Price
PH311713 ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859526) 10 ug
$3,360.00
PH311723 ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859525) 10 ug
$3,360.00
LC405645 Lyophilized ORC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405646 Lyophilized ORC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419257 Lyophilized ORC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433812 Lyophilized ORC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405645 Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY405646 Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY419257 Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY433812 Transient overexpression lysate of origin recognition complex, subunit 4 (ORC4), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP301587 Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2, 20 µg 20 ug
$867.00
TP311713 Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3, 20 µg 20 ug
$867.00
TP311723 Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products