OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SSNA1 (NM_003731) Human Mass Spec Standard

Be the first to review this product
SKU
PH301557
SSNA1 MS Standard C13 and N15-labeled recombinant protein (NP_003722)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA325065 SSNA1 Antibody (N-term)
400 ul
$645.00
LY418471 Transient overexpression lysate of Sjogren syndrome nuclear autoantigen 1 (SSNA1) (as WB positive control) 100 ug
$436.00

Other products for "SSNA1 or NM_003731"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201557
Predicted MW 13.6 kDa
Protein Sequence
Protein Sequence
>RC201557 protein sequence
Red=Cloning site Green=Tags(s)

MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNE
FDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003722
RefSeq Size 954
RefSeq ORF 357
Synonyms N14; NA-14; NA14
Locus ID 8636
UniProt ID O43805
Cytogenetics 9q34.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SSNA1" proteins (3)
SKU Description Size Price
LC418471 Lyophilized SSNA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418471 Transient overexpression lysate of Sjogren syndrome nuclear autoantigen 1 (SSNA1) (as WB positive control) 100 ug
$436.00
TP301557 Recombinant protein of human Sjogren syndrome nuclear autoantigen 1 (SSNA1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products