OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STAP2 (NM_001013841) Human Mass Spec Standard

Be the first to review this product
SKU
PH301518
STAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001013863)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308170 Rabbit Polyclonal antibody to STAP2 (signal transducing adaptor family member 2)
100 ul
$665.00
LY413599 Transient overexpression lysate of signal transducing adaptor family member 2 (STAP2), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "STAP2 or NM_001013841"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201518
Predicted MW 44.9 kDa
Protein Sequence
Protein Sequence
>RC201518 protein sequence
Red=Cloning site Green=Tags(s)

MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEK
LTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLA
KEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREG
PKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAP
CTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPK
PPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001013863
RefSeq Size 1419
RefSeq ORF 1209
Synonyms BKS
Locus ID 55620
UniProt ID Q9UGK3
Cytogenetics 19p13.3
Summary This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STAP2" proteins (5)
SKU Description Size Price
LC413599 Lyophilized STAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423042 Lyophilized STAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413599 Transient overexpression lysate of signal transducing adaptor family member 2 (STAP2), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY423042 Transient overexpression lysate of signal transducing adaptor family member 2 (STAP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301518 Recombinant protein of human signal transducing adaptor family member 2 (STAP2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products