OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARL5A (NM_001037174) Human Mass Spec Standard

Be the first to review this product
SKU
PH301516
ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_001032251)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA371859 ARL5A rabbit polyclonal antibody
100 ul
$310.00
LY415981 Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ARL5A or NM_001037174"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201516
Predicted MW 20.73 kDa
Protein Sequence
Protein Sequence
>RC201516 representing NM_001037174
Red=Cloning site Green=Tags(s)

MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ
ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ
FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032251
RefSeq Size 2913
RefSeq ORF 537
Synonyms ARFLP5; ARL5
Locus ID 26225
UniProt ID Q9Y689
Cytogenetics 2q23.3
Summary The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARL5A" proteins (7)
SKU Description Size Price
PH315504 ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_036229) 10 ug
$3,360.00
LC415981 Lyophilized ARL5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421930 Lyophilized ARL5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415981 Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421930 Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301516 Purified recombinant protein of Homo sapiens ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3, 20 µg 20 ug
$867.00
TP315504 Recombinant protein of human ADP-ribosylation factor-like 5A (ARL5A), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products