OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZDHHC4 (NM_018106) Human Mass Spec Standard

Be the first to review this product
SKU
PH301489
ZDHHC4 MS Standard C13 and N15-labeled recombinant protein (NP_060576)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402650 Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "ZDHHC4 or NM_018106"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201489
Predicted MW 39.8 kDa
Protein Sequence
Protein Sequence
>RC201489 protein sequence
Red=Cloning site Green=Tags(s)

MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIV
LHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEF
DEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAI
VSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYL
AATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060576
RefSeq Size 1413
RefSeq ORF 1032
Synonyms ZNF374
Locus ID 55146
UniProt ID Q9NPG8
Cytogenetics 7p22.1
Summary Palmitoyltransferase that could catalyze the addition of palmitate onto protein substrates including the D(2) dopamine receptor DRD2.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZDHHC4" proteins (10)
SKU Description Size Price
LC402650 Lyophilized ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427411 Lyophilized ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427412 Lyophilized ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427413 Lyophilized ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402650 Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427411 Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427412 Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427413 Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP301489 Recombinant protein of human zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3, 20 µg 20 ug
$867.00
TP761502 Purified recombinant protein of Human zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products