OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB3C (NM_138453) Human Mass Spec Standard

Be the first to review this product
SKU
PH301436
RAB3C MS Standard C13 and N15-labeled recombinant protein (NP_612462)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322076 Anti-RAB3C Rabbit Polyclonal Antibody
100 ul
$305.00
LY408603 Transient overexpression lysate of RAB3C, member RAS oncogene family (RAB3C) (as WB positive control) 100 ug
$436.00

Other products for "RAB3C or NM_138453"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201436
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC201436 protein sequence
Red=Cloning site Green=Tags(s)

MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK
TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL
VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ
NTRLKETPPPPQPNCAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612462
RefSeq Size 1030
RefSeq ORF 681
Locus ID 115827
UniProt ID Q96E17
Cytogenetics 5q11.2
Summary This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB3C" proteins (3)
SKU Description Size Price
LC408603 Lyophilized RAB3C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408603 Transient overexpression lysate of RAB3C, member RAS oncogene family (RAB3C) (as WB positive control) 100 ug
$436.00
TP301436 Recombinant protein of human RAB3C, member RAS oncogene family (RAB3C), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products