OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXS1 (NM_004118) Human Mass Spec Standard

Be the first to review this product
SKU
PH301400
FOXS1 MS Standard C13 and N15-labeled recombinant protein (NP_004109)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322788 Anti-FOXS1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY418193 Transient overexpression lysate of forkhead box S1 (FOXS1) (as WB positive control) 100 ug
$436.00

Other products for "FOXS1 or NM_004118"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201400
Predicted MW 35.4 kDa
Protein Sequence
Protein Sequence
>RC201400 protein sequence
Red=Cloning site Green=Tags(s)

MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNL
SLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQD
PGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVAT
SSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPT
PPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004109
RefSeq Size 1353
RefSeq ORF 990
Synonyms FKHL18; FREAC10
Locus ID 2307
UniProt ID O43638
Cytogenetics 20q11.21
Summary The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXS1" proteins (3)
SKU Description Size Price
LC418193 Lyophilized FOXS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418193 Transient overexpression lysate of forkhead box S1 (FOXS1) (as WB positive control) 100 ug
$436.00
TP301400 Recombinant protein of human forkhead box S1 (FOXS1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products