OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TCTA (NM_022171) Human Mass Spec Standard

Be the first to review this product
SKU
PH301387
TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382384 TCTA Rabbit polyclonal Antibody
100 ul
$410.00
LY411726 Transient overexpression lysate of T-cell leukemia translocation altered gene (TCTA) (as WB positive control) 100 ug
$436.00

Other products for "TCTA or NM_022171"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201387
Predicted MW 11.3 kDa
Protein Sequence
Protein Sequence
>RC201387 protein sequence
Red=Cloning site Green=Tags(s)

MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHR
PGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071503
RefSeq Size 2172
RefSeq ORF 309
Locus ID 6988
UniProt ID P57738
Cytogenetics 3p21.31
Summary May be required for cellular fusion during osteoclastogenesis.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TCTA" proteins (3)
SKU Description Size Price
LC411726 Lyophilized TCTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411726 Transient overexpression lysate of T-cell leukemia translocation altered gene (TCTA) (as WB positive control) 100 ug
$436.00
TP301387 Recombinant protein of human T-cell leukemia translocation altered gene (TCTA), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products