OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STEEP1 (NM_022101) Human Mass Spec Standard

Be the first to review this product
SKU
PH301305
CXorf56 MS Standard C13 and N15-labeled recombinant protein (NP_071384)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331780 Rabbit Polyclonal Anti-CXorf56 Antibody
100 ul
$585.00
LY411776 Transient overexpression lysate of chromosome X open reading frame 56 (CXorf56), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CXorf56 or NM_022101"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201305
Predicted MW 25.4 kDa
Protein Sequence
Protein Sequence
>RC201305 representing NM_022101
Red=Cloning site Green=Tags(s)

MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCN
TEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPK
KVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKA
KMKGTLIDNQFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071384
RefSeq Size 904
RefSeq ORF 666
Synonyms MRX107
Locus ID 63932
UniProt ID Q9H5V9
Cytogenetics Xq24
Summary While this gene is well-supported by transcript data, no functional information on its protein products is currently available. Three transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CXorf56" proteins (5)
SKU Description Size Price
LC411776 Lyophilized CXorf56 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432632 Lyophilized CXorf56 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411776 Transient overexpression lysate of chromosome X open reading frame 56 (CXorf56), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432632 Transient overexpression lysate of chromosome X open reading frame 56 (CXorf56), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301305 Recombinant protein of human chromosome X open reading frame 56 (CXorf56), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products