OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APPD (PLEKHF1) (NM_024310) Human Mass Spec Standard

Be the first to review this product
SKU
PH301282
PLEKHF1 MS Standard C13 and N15-labeled recombinant protein (NP_077286)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA363812 APPD Antibody - C-terminal region
100 ul
$525.00
LY402983 Transient overexpression lysate of pleckstrin homology domain containing, family F (with FYVE domain) member 1 (PLEKHF1) (as WB positive control) 100 ug
$436.00

Other products for "APPD or NM_024310"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201282
Predicted MW 31.2 kDa
Protein Sequence
Protein Sequence
>RC201282 protein sequence
Red=Cloning site Green=Tags(s)

MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLN
KRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECVRRQLRATGRP
PSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYRE
LAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077286
RefSeq Size 1774
RefSeq ORF 837
Synonyms APPD; LAPF; PHAFIN1; ZFYVE15
Locus ID 79156
UniProt ID Q96S99
Cytogenetics 19q12
Summary May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-independent apoptosis by altering mitochondrial membrane permeabilization (MMP) resulting in the release of PDCD8.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APPD" proteins (3)
SKU Description Size Price
LC402983 Lyophilized PLEKHF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402983 Transient overexpression lysate of pleckstrin homology domain containing, family F (with FYVE domain) member 1 (PLEKHF1) (as WB positive control) 100 ug
$436.00
TP301282 Recombinant protein of human pleckstrin homology domain containing, family F (with FYVE domain) member 1 (PLEKHF1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products