OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SSX2 (NM_003147) Human Mass Spec Standard

Be the first to review this product
SKU
PH301214
SSX2 MS Standard C13 and N15-labeled recombinant protein (NP_003138)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500620 Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10) 100 ul
$447.00
LY418870 Transient overexpression lysate of synovial sarcoma, X breakpoint 2 (SSX2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SSX2 or NM_003147"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201214
Predicted MW 25.2 kDa
Protein Sequence
Protein Sequence
>RC201214 protein sequence
Red=Cloning site Green=Tags(s)

MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF
MCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELC
PPGKPTTSEKIHERSGNREAQEKEERRGTAHRWSSQNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGN
MPGPTDCVRENSW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003138
RefSeq Size 1494
RefSeq ORF 669
Synonyms CT5.2; CT5.2A; HD21; HOM-MEL-40; SSX
Locus ID 6757
UniProt ID Q16385
Cytogenetics Xp11.22
Summary The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. This gene, and also the SSX1 and SSX4 family members, have been involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are likely responsible for transforming activity. Alternative splicing of this gene results in multiple transcript variants. This gene also has an identical duplicate, GeneID: 727837, located about 45 kb downstream in the opposite orientation on chromosome X. provided by RefSeq, Jul 2013
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SSX2" proteins (7)
SKU Description Size Price
PH303504 SSX2 MS Standard C13 and N15-labeled recombinant protein (NP_783629) 10 ug
$3,360.00
LC406256 Lyophilized SSX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418870 Lyophilized SSX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406256 Transient overexpression lysate of synovial sarcoma, X breakpoint 2 (SSX2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418870 Transient overexpression lysate of synovial sarcoma, X breakpoint 2 (SSX2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301214 Recombinant protein of human synovial sarcoma, X breakpoint 2 (SSX2), transcript variant 1, 20 µg 20 ug
$867.00
TP303504 Recombinant protein of human synovial sarcoma, X breakpoint 2 (SSX2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products