cleavage stimulation factor (CSTF1) (NM_001324) Human Mass Spec Standard

SKU
PH301128
CSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_001315)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201128]
Predicted MW 48.4 kDa
Protein Sequence
Protein Sequence
>RC201128 protein sequence
Red=Cloning site Green=Tags(s)

MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIG
RSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERM
LAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRA
FKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTG
SKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLS
GRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR
ARFWYRRSTTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001315
RefSeq Size 2323
RefSeq ORF 1293
Synonyms CstF-50; CstFp50
Locus ID 1477
UniProt ID Q05048
Cytogenetics 20q13.2-q13.31
Summary This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:cleavage stimulation factor (CSTF1) (NM_001324) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316135 CSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_001028694) 10 ug
$3,255.00
LC420000 CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422380 CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422381 CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425563 CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425564 CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420000 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 2 100 ug
$436.00
LY422380 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 1 100 ug
$665.00
LY422381 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3 100 ug
$665.00
LY425563 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 1 100 ug
$436.00
LY425564 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3 100 ug
$436.00
TP301128 Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316135 Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.