OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

cleavage stimulation factor (CSTF1) (NM_001324) Human Mass Spec Standard

Be the first to review this product
SKU
PH301128
CSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_001315)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA590762 Rabbit Polyclonal cleavage stimulation factor Antibody
100 ug
$482.00
LY420000 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "cleavage stimulation factor or NM_001324"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201128
Predicted MW 48.4 kDa
Protein Sequence
Protein Sequence
>RC201128 protein sequence
Red=Cloning site Green=Tags(s)

MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIG
RSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERM
LAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRA
FKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTG
SKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLS
GRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR
ARFWYRRSTTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001315
RefSeq Size 2323
RefSeq ORF 1293
Synonyms CstF-50; CstFp50
Locus ID 1477
UniProt ID Q05048
Cytogenetics 20q13.2-q13.31
Summary This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "cleavage stimulation factor" proteins (13)
SKU Description Size Price
PH316135 CSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_001028694) 10 ug
$3,360.00
LC420000 Lyophilized CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422380 Lyophilized CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422381 Lyophilized CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425563 Lyophilized CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425564 Lyophilized CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420000 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422380 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY422381 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY425563 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY425564 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301128 Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 2, 20 µg 20 ug
$867.00
TP316135 Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products