OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRIM44 (NM_017583) Human Mass Spec Standard

Be the first to review this product
SKU
PH301074
TRIM44 MS Standard C13 and N15-labeled recombinant protein (NP_060053)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505561 TRIM44 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10) 100 ul
$447.00
LY413678 Transient overexpression lysate of tripartite motif-containing 44 (TRIM44) (as WB positive control) 100 ug
$436.00

Other products for "TRIM44 or NM_017583"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201074
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC201074 protein sequence
Red=Cloning site Green=Tags(s)

MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPP
ADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESE
AEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGH
QLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHL
VDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060053
RefSeq Size 4337
RefSeq ORF 1032
Synonyms AN3; DIPB; HSA249128; MC7
Locus ID 54765
UniProt ID Q96DX7
Cytogenetics 11p13
Summary This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRIM44" proteins (3)
SKU Description Size Price
LC413678 Lyophilized TRIM44 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413678 Transient overexpression lysate of tripartite motif-containing 44 (TRIM44) (as WB positive control) 100 ug
$436.00
TP301074 Recombinant protein of human tripartite motif-containing 44 (TRIM44), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products