OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM70 (NM_017866) Human Mass Spec Standard

Be the first to review this product
SKU
PH301060
TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306941 Rabbit Polyclonal TMEM70 Antibody
100 ug
$640.00
LY413488 Transient overexpression lysate of transmembrane protein 70 (TMEM70), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TMEM70 or NM_017866"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201060
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC201060 protein sequence
Red=Cloning site Green=Tags(s)

MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQ
IPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPI
QIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFT
TFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060336
RefSeq Size 2096
RefSeq ORF 780
Synonyms MC5DN2
Locus ID 54968
UniProt ID Q9BUB7
Cytogenetics 8q21.11
Summary This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. provided by RefSeq, Feb 2010
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM70" proteins (5)
SKU Description Size Price
LC413488 Lyophilized TMEM70 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421778 Lyophilized TMEM70 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413488 Transient overexpression lysate of transmembrane protein 70 (TMEM70), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421778 Transient overexpression lysate of transmembrane protein 70 (TMEM70), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301060 Recombinant protein of human transmembrane protein 70 (TMEM70), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products