OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WT1-AS (NM_015855) Human Mass Spec Standard

Be the first to review this product
SKU
PH301018
WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414347 Transient overexpression lysate of Wilms tumor upstream neighbor 1 (WIT1) (as WB positive control) 100 ug
$436.00

Other products for "WIT1 or NM_015855"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201018
Predicted MW 9.9 kDa
Protein Sequence
Protein Sequence
>RC201018 representing NM_015855
Red=Cloning site Green=Tags(s)

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQP
QPQGPVRTPGPPSGSHPAAADN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056939
RefSeq Size 1962
RefSeq ORF 276
Synonyms WIT-1, dJ74J1.1, MGC120207, MGC120208, MGC120209
Locus ID 51352
Cytogenetics 11p13
Summary This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis. provided by RefSeq, May 2014
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WIT1" proteins (3)
SKU Description Size Price
LC414347 Lyophilized WIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414347 Transient overexpression lysate of Wilms tumor upstream neighbor 1 (WIT1) (as WB positive control) 100 ug
$436.00
TP301018 Recombinant protein of human Wilms tumor upstream neighbor 1 (WIT1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products