OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTL3 (CFAP20) (NM_013242) Human Mass Spec Standard

Be the first to review this product
SKU
PH301017
C16orf80 MS Standard C13 and N15-labeled recombinant protein (NP_037374)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335647 Rabbit Polyclonal Anti-C16orf80 Antibody
100 ul
$585.00
LY415720 Transient overexpression lysate of chromosome 16 open reading frame 80 (C16orf80) (as WB positive control) 100 ug
$436.00

Other products for "GTL3 or NM_013242"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201017
Predicted MW 22.8 kDa
Protein Sequence
Protein Sequence
>RC201017 protein sequence
Red=Cloning site Green=Tags(s)

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG
IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFT
RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037374
RefSeq Size 1308
RefSeq ORF 579
Synonyms BUG22; C16orf80; EVORF; fSAP23; GTL3
Locus ID 29105
UniProt ID Q9Y6A4
Cytogenetics 16q21
Summary Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia (PubMed:24414207). Required for axonemal microtubules polyglutamylation (PubMed:24414207).UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GTL3" proteins (3)
SKU Description Size Price
LC415720 Lyophilized CFAP20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415720 Transient overexpression lysate of chromosome 16 open reading frame 80 (C16orf80) (as WB positive control) 100 ug
$436.00
TP301017 Recombinant protein of human chromosome 16 open reading frame 80 (C16orf80), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products