CLDND1 (NM_019895) Human Mass Spec Standard

SKU
PH301014
CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201014]
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC201014 protein sequence
Red=Cloning site Green=Tags(s)

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR
YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ
FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG
EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_063948
RefSeq Size 2244
RefSeq ORF 759
Synonyms C3orf4; GENX-3745; Z38
Locus ID 56650
UniProt ID Q9NY35
Cytogenetics 3q11.2
Protein Families Transmembrane
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
LC412679 CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421715 CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421717 CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421724 CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421725 CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412679 Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 2 100 ug
$436.00
LY421715 Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 1 100 ug
$436.00
LY421717 Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 3 100 ug
$436.00
LY421724 Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 6 100 ug
$436.00
LY421725 Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 7 100 ug
$436.00
TP301014 Recombinant protein of human claudin domain containing 1 (CLDND1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.