CLDND1 (NM_019895) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201014] |
Predicted MW | 28.6 kDa |
Protein Sequence |
Protein Sequence
>RC201014 protein sequence
Red=Cloning site Green=Tags(s) MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_063948 |
RefSeq Size | 2244 |
RefSeq ORF | 759 |
Synonyms | C3orf4; GENX-3745; Z38 |
Locus ID | 56650 |
UniProt ID | Q9NY35 |
Cytogenetics | 3q11.2 |
Protein Families | Transmembrane |
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC412679 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421715 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421717 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421724 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421725 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY412679 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 2 | 100 ug |
$436.00
|
|
LY421715 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 1 | 100 ug |
$436.00
|
|
LY421717 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 3 | 100 ug |
$436.00
|
|
LY421724 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 6 | 100 ug |
$436.00
|
|
LY421725 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 7 | 100 ug |
$436.00
|
|
TP301014 | Recombinant protein of human claudin domain containing 1 (CLDND1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.