OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC37 (NM_007065) Human Mass Spec Standard

Be the first to review this product
SKU
PH301002
CDC37 MS Standard C13 and N15-labeled recombinant protein (NP_008996)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322445 Anti-CDC37 Rabbit Polyclonal Antibody
100 ul
$305.00
LY416229 Transient overexpression lysate of cell division cycle 37 homolog (S. cerevisiae) (CDC37) (as WB positive control) 100 ug
$436.00

Other products for "CDC37 or NM_007065"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201002
Predicted MW 44.5 kDa
Protein Sequence
Protein Sequence
>RC201002 protein sequence
Red=Cloning site Green=Tags(s)

MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKE
LEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDS
EEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVA
HQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEE
EERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASE
AKEGEEAGPGDPLLEAVPKTGDEKDVSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008996
RefSeq Size 1693
RefSeq ORF 1134
Synonyms P50CDC37
Locus ID 11140
UniProt ID Q16543
Cytogenetics 19p13.2
Summary The protein encoded by this gene is highly similar to Cdc 37, a cell division cycle control protein of Sacchromyces cerevisiae. This protein is a molecular chaperone with specific function in cell signal transduction. It has been shown to form complex with Hsp90 and a variety of protein kinases including CDK4, CDK6, SRC, RAF-1, MOK, as well as eIF2 alpha kinases. It is thought to play a critical role in directing Hsp90 to its target kinases. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDC37" proteins (3)
SKU Description Size Price
LC416229 Lyophilized CDC37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416229 Transient overexpression lysate of cell division cycle 37 homolog (S. cerevisiae) (CDC37) (as WB positive control) 100 ug
$436.00
TP301002 Recombinant protein of human cell division cycle 37 homolog (S. cerevisiae) (CDC37), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products