OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SSBP4 (NM_032627) Human Mass Spec Standard

Be the first to review this product
SKU
PH300988
SSBP4 MS Standard C13 and N15-labeled recombinant protein (NP_116016)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350448 Rabbit Polyclonal Anti-SSBP4 Antibody
100 ul
$205.00
LY409995 Transient overexpression lysate of single stranded DNA binding protein 4 (SSBP4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SSBP4 or NM_032627"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200988
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC200988 protein sequence
Red=Cloning site Green=Tags(s)

MYAKGGKGSAVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDL
YCAAPDRREACEHSGEAKAFQDYSAAAAPSPVMGSMAPGDTMAAGSMAAGFFQGPPGSQPSPHNPNAPMM
GPHGQPFMSPRFPGGPRPTLRMPSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQRVTPPRGMASVG
PQSYGGGMRPPPNSLAGPGLPAMNMGPGVRGPWASPSGNSIPYSSSSPGSYTGPPGGGGPPGTPIMPSPG
DSTNSSENMYTIMNPIGQGAGRANFPLGPGPEGPMAAMSAMEPHHVNGSLGSGDMDGLPKSSPGAVAGLS
NAPGTPRDDGEMAAAGTFLHPFPSESYSPGMTMSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116016
RefSeq Size 1817
RefSeq ORF 1155
Locus ID 170463
UniProt ID Q9BWG4
Cytogenetics 19p13.11
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SSBP4" proteins (7)
SKU Description Size Price
PH318268 SSBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001009998) 10 ug
$3,360.00
LC409995 Lyophilized SSBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423175 Lyophilized SSBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409995 Transient overexpression lysate of single stranded DNA binding protein 4 (SSBP4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423175 Transient overexpression lysate of single stranded DNA binding protein 4 (SSBP4), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300988 Recombinant protein of human single stranded DNA binding protein 4 (SSBP4), transcript variant 1, 20 µg 20 ug
$737.00
TP318268 Recombinant protein of human single stranded DNA binding protein 4 (SSBP4), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products