OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRHPR (NM_012203) Human Mass Spec Standard

Be the first to review this product
SKU
PH300963
GRHPR MS Standard C13 and N15-labeled recombinant protein (NP_036335)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502091 GRHPR mouse monoclonal antibody, clone OTI2H4 (formerly 2H4) 100 ul
$447.00
LY415912 Transient overexpression lysate of glyoxylate reductase/hydroxypyruvate reductase (GRHPR) (as WB positive control) 100 ug
$436.00

Other products for "GRHPR or NM_012203"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200963
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC200963 protein sequence
Red=Cloning site Green=Tags(s)

MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA
AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS
WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD
FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH
PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036335
RefSeq Size 1235
RefSeq ORF 984
Synonyms GLXR; GLYD; PH2
Locus ID 9380
UniProt ID Q9UBQ7
Cytogenetics 9p13.2
Summary This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRHPR" proteins (3)
SKU Description Size Price
LC415912 Lyophilized GRHPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415912 Transient overexpression lysate of glyoxylate reductase/hydroxypyruvate reductase (GRHPR) (as WB positive control) 100 ug
$436.00
TP300963 Recombinant protein of human glyoxylate reductase/hydroxypyruvate reductase (GRHPR), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products