OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C7orf25 (NM_024054) Human Mass Spec Standard

Be the first to review this product
SKU
PH300908
C7orf25 MS Standard C13 and N15-labeled recombinant protein (NP_076959)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY420211 Transient overexpression lysate of chromosome 7 open reading frame 25 (C7orf25), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "C7orf25 or NM_024054"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200908
Predicted MW 46.5 kDa
Protein Sequence
Protein Sequence
>RC200908 protein sequence
Red=Cloning site Green=Tags(s)

MSAHSMLCERIAIAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKVEAGKVAIKESHLQSTNLT
HLRAIVESAENLEEVVSVLHVFGYTDTLGEKQTLVVDVVANGGHTWVKAIGRKAEALHNIWLGRGQYGDK
SIIEQAEDFLQASHQQPVQYSNPHIIFAFYNSVSSPMAEKLKEMGISVRGDIVAVNALLDHPEELQPSES
ESDDEGPELLQVTRVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQA
EQERKEQVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERATVLIKRINVVPDQPSERALRLVA
SSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALATPLPKDYTTDSE
H

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076959
RefSeq Size 1839
RefSeq ORF 1263
Locus ID 79020
UniProt ID Q9BPX7
Cytogenetics 7p14.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C7orf25" proteins (5)
SKU Description Size Price
LC411373 Lyophilized C7orf25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420211 Lyophilized C7orf25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411373 Transient overexpression lysate of chromosome 7 open reading frame 25 (C7orf25), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420211 Transient overexpression lysate of chromosome 7 open reading frame 25 (C7orf25), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP300908 Recombinant protein of human chromosome 7 open reading frame 25 (C7orf25), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products