OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ABHD14A (NM_015407) Human Mass Spec Standard

Be the first to review this product
SKU
PH300785
ABHD14A MS Standard C13 and N15-labeled recombinant protein (NP_056222)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331955 Rabbit Polyclonal Anti-ABHD14A Antibody
100 ul
$585.00
LY414572 Transient overexpression lysate of abhydrolase domain containing 14A (ABHD14A) (as WB positive control) 100 ug
$436.00

Other products for "ABHD14A or NM_015407"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200785
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC200785 protein sequence
Red=Cloning site Green=Tags(s)

MVGALCGCWFRLGGARPLIPLGPTVVQTSMSQSQVALLGLSLLLMLLLYVGLPGPPEQTSCLWGDPNVTV
LAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPS
KEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWAV
KTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056222
RefSeq Size 1118
RefSeq ORF 813
Synonyms DORZ1
Locus ID 25864
UniProt ID Q9BUJ0
Cytogenetics 3p21.2
Summary Possible role in granule neuron development.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ABHD14A" proteins (3)
SKU Description Size Price
LC414572 Lyophilized ABHD14A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414572 Transient overexpression lysate of abhydrolase domain containing 14A (ABHD14A) (as WB positive control) 100 ug
$436.00
TP300785 Recombinant protein of human abhydrolase domain containing 14A (ABHD14A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products