OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TGF beta induced factor 2 (TGIF2) (NM_021809) Human Mass Spec Standard

Be the first to review this product
SKU
PH300773
TGIF2 MS Standard C13 and N15-labeled recombinant protein (NP_068581)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411916 Transient overexpression lysate of TGFB-induced factor homeobox 2 (TGIF2) (as WB positive control) 100 ug
$436.00

Other products for "TGF beta induced factor 2 or NM_021809"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200773
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC200773 protein sequence
Red=Cloning site Green=Tags(s)

MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI
NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE
KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA
EMELQKQQDPSLPLLHTPIPLVSENPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068581
RefSeq Size 3415
RefSeq ORF 711
Locus ID 60436
UniProt ID Q9GZN2
Cytogenetics 20q11.23
Summary The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor, which appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and over-expressed in some ovarian cancers. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. Read-through transcription also exists between this gene and the neighboring downstream C20orf24 (chromosome 20 open reading frame 24) gene. provided by RefSeq, Dec 2010
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TGF beta induced factor 2" proteins (3)
SKU Description Size Price
LC411916 Lyophilized TGIF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411916 Transient overexpression lysate of TGFB-induced factor homeobox 2 (TGIF2) (as WB positive control) 100 ug
$436.00
TP300773 Recombinant protein of human TGFB-induced factor homeobox 2 (TGIF2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products